|
TA02510 | TA02510-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1581 | TA02510 | aspartyl protease precursor, putative | aspartyl protease precursor, putative | 3865083 | Q4UD05 | 3 | CR940352:112,231..114,545(-) | CR940352:112231..114545(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_100536 | 0 | 526 | 1581 | 59780 | 6.30 | 1 | HMM: MKLDIIRFSTLIFILGVFTFSPVSPL, NN: MKLDIIRFSTLIFILGVFTF | NN Sum: 4, NN D: .77, HMM Prob: .69 | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA02510ORaspartyl protease precursor, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA02510 OR aspartyl protease precursor, putative AND Theileria annulata strain Ankara |
|
TA02750 | TA02750-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1560 | TA02750 | pepsinogen, putative | pepsinogen, putative | 3863964 | Q4UHM4 | 1 | tannA_chr01:1,437,868..1,440,251(+) | tannA_chr01:1437868..1440251(+) | tannA_chr01 | Theileria annulata strain Ankara | 19 | OG6_119797 | 2 | 519 | 1560 | 58620 | 7.87 | 0 | HMM: MIKCIIIAIIIKLINTL, NN: MIKCIIIAIIIKLINTL | NN Sum: 4, NN D: .82, HMM Prob: .51 | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=TA02750ORpepsinogen, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA02750 OR pepsinogen, putative AND Theileria annulata strain Ankara |
|
TA02875 | TA02875-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1284 | TA02875 | hypothetical protein, conserved | hypothetical protein, conserved | 3864420 | Q4UHJ9 | 1 | tannA_chr01:1,372,140..1,373,528(+) | tannA_chr01:1372140..1373528(+) | tannA_chr01 | Theileria annulata strain Ankara | 181 | OG6_100231 | 2 | 427 | 1284 | 49253 | 7.94 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA02875ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA02875 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA02980 | TA02980-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2349 | TA02980 | integral membrane protein (apical merozoite antigen), putative | integral membrane protein (apical merozoite antigen), putative | 3864401 | Q4UHH9 | 1 | tannA_chr01:1,324,091..1,326,439(+) | tannA_chr01:1324091..1326439(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_130922 | 0 | 782 | 2349 | 88241 | 7.70 | 1 | | | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA02980ORintegral membrane protein (apical merozoite antigen), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA02980 OR integral membrane protein (apical merozoite antigen), putative AND Theileria annulata strain Ankara |
|
TA03315 | TA03315-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2379 | TA03315 | phospholipase, putative | phospholipase, putative | 3865326 | Q4UCN1 | 3 | CR940352:404,037..406,541(-) | CR940352:404037..406541(-) | CR940352 | Theileria annulata strain Ankara | 181 | OG6_100231 | 2 | 792 | 2379 | 90470 | 8.94 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03315ORphospholipase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03315 OR phospholipase, putative AND Theileria annulata strain Ankara |
|
TA03480 | TA03480-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 3093 | TA03480 | hypothetical protein, conserved | hypothetical protein, conserved | 3864630 | Q4UCK1 | 3 | CR940352:474,688..478,163(-) | CR940352:474688..478163(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_113142 | 0 | 1030 | 3093 | 118367 | 8.71 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA03480ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03480 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA03560 | TA03560-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 1536 | TA03560 | hypothetical protein, conserved | hypothetical protein, conserved | 3865014 | Q4UCI5 | 3 | CR940352:526,927..528,749(-) | CR940352:526927..528749(-) | CR940352 | Theileria annulata strain Ankara | 10 | OG6_134153 | 0 | 511 | 1536 | 58650 | 9.07 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03560ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03560 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA03720 | TA03720-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1341 | TA03720 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864601 | Q4UCF7 | 3 | CR940352:576,922..578,324(+) | CR940352:576922..578324(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 446 | 1341 | 50511 | 7.08 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03720ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03720 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03725 | TA03725-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1344 | TA03725 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864602 | Q4UCF6 | 3 | CR940352:578,681..580,086(+) | CR940352:578681..580086(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 447 | 1344 | 50851 | 7.18 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03725ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03725 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03730 | TA03730-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1497 | TA03730 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864603 | Q4UCF5 | 3 | CR940352:581,004..582,500(+) | CR940352:581004..582500(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 498 | 1497 | 57356 | 9.02 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03730ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03730 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03735 | TA03735-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1386 | TA03735 | cysteine protease precursor, tacP, putative | cysteine protease precursor, tacP, putative | 3864604 | Q4UCF4 | 3 | CR940352:582,685..584,111(+) | CR940352:582685..584111(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 461 | 1386 | 53188 | 6.84 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03735ORcysteine protease precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03735 OR cysteine protease precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03740 | TA03740-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1326 | TA03740 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864605 | P25781 | 3 | CR940352:584,825..586,150(+) | CR940352:584825..586150(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 441 | 1326 | 49664 | 8.74 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03740ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03740 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03745 | TA03745-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1329 | TA03745 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864606 | Q4UCF2 | 3 | CR940352:586,517..587,877(+) | CR940352:586517..587877(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 442 | 1329 | 50897 | 7.92 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03745ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03745 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03750 | TA03750-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1317 | TA03750 | cysteine proteinase precursor, tacP, putative | cysteine proteinase precursor, tacP, putative | 3864607 | Q4UCF1 | 3 | CR940352:588,241..589,589(+) | CR940352:588241..589589(+) | CR940352 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 438 | 1317 | 49992 | 7.67 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03750ORcysteine proteinase precursor, tacP, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03750 OR cysteine proteinase precursor, tacP, putative AND Theileria annulata strain Ankara |
|
TA03785 | TA03785-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 771 | TA03785 | proteasome subnit, putative | proteasome subnit, putative | 3864830 | Q4UCE5 | 3 | CR940352:610,615..611,525(-) | CR940352:610615..611525(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_102011 | 0 | 256 | 771 | 28244 | 5.77 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03785ORproteasome subnit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03785 OR proteasome subnit, putative AND Theileria annulata strain Ankara |
|
TA03860 | TA03860-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 885 | TA03860 | pepsinogen, putative | pepsinogen, putative | 3864845 | Q4UCD1 | 3 | CR940352:641,297..642,974(-) | CR940352:641297..642974(-) | CR940352 | Theileria annulata strain Ankara | 19 | OG6_119797 | 2 | 294 | 885 | 33817 | 4.89 | 0 | | | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=TA03860ORpepsinogen, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA03860 OR pepsinogen, putative AND Theileria annulata strain Ankara |
|
TA04050 | TA04050-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1584 | TA04050 | hypothetical protein, conserved | hypothetical protein, conserved | 3865224 | Q4UC93 | 3 | CR940352:731,384..732,967(-) | CR940352:731384..732967(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_154686 | 0 | 527 | 1584 | 60189 | 6.10 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA04050ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04050 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA04105 | TA04105-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1584 | TA04105 | cysteine proteinase, putative | cysteine proteinase, putative | 3865389 | Q4UC83 | 3 | CR940352:749,151..750,915(-) | CR940352:749151..750915(-) | CR940352 | Theileria annulata strain Ankara | 17 | OG6_103622 | 1 | 527 | 1584 | 59847 | 6.36 | 0 | HMM: MKILLVNAVLLFYICKNVVAD, NN: MKILLVNAVLLFYICKNVVAD | NN Sum: 4, NN D: .82, HMM Prob: .93 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TA04105ORcysteine proteinase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04105 OR cysteine proteinase, putative AND Theileria annulata strain Ankara |
|
TA04130 | TA04130-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1002 | TA04130 | hypothetical protein, conserved | hypothetical protein, conserved | 3865394 | Q4UC78 | 3 | CR940352:759,209..760,338(-) | CR940352:759209..760338(-) | CR940352 | Theileria annulata strain Ankara | 26 | OG6_100915 | 1 | 333 | 1002 | 38314 | 6.77 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA04130ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04130 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA04310 | TA04310-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 765 | TA04310 | 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 3864801 | Q4UCX0 | 3 | CR940352:201,574..204,294(-) | CR940352:201574..204294(-) | CR940352 | Theileria annulata strain Ankara | 8 | OG6_101257 | 0 | 254 | 765 | 27264 | 9.11 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA04310OR4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04310 OR 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative AND Theileria annulata strain Ankara |
|
TA04475 | TA04475-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 498 | TA04475 | hypothetical protein, conserved | hypothetical protein, conserved | 3865269 | Q4UC17 | 3 | CR940352:886,642..887,453(-) | CR940352:886642..887453(-) | CR940352 | Theileria annulata strain Ankara | 15 | OG6_102272 | 0 | 165 | 498 | 18989 | 9.47 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA04475ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04475 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA04595 | TA04595-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 690 | TA04595 | proteasome subunit, putative | proteasome subunit, putative | 3864897 | Q4UBZ5 | 3 | CR940352:930,232..931,177(-) | CR940352:930232..931177(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_101718 | 0 | 229 | 690 | 25767 | 8.18 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA04595ORproteasome subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04595 OR proteasome subunit, putative AND Theileria annulata strain Ankara |
|
TA04615 | TA04615-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 3246 | TA04615 | hypothetical protein, conserved | hypothetical protein, conserved | 3864901 | Q4UBZ1 | 3 | CR940352:935,228..938,703(+) | CR940352:935228..938703(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_102131 | 0 | 1081 | 3246 | 121715 | 4.59 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA04615ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04615 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA04875 | TA04875-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 4827 | TA04875 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3864933 | Q4UBT6 | 3 | CR940352:1,092,847..1,097,933(-) | CR940352:1092847..1097933(-) | CR940352 | Theileria annulata strain Ankara | 10 | OG6_101317 | 0 | 1608 | 4827 | 185305 | 5.05 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TA04875ORubiquitin carboxyl-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA04875 OR ubiquitin carboxyl-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA05020 | TA05020-t26_1 | 10 | 10 | 1 | | | reverse | protein coding | No | 1893 | TA05020 | hypothetical protein, conserved | hypothetical protein, conserved | 3864706 | Q4UBR0 | 3 | CR940352:1,140,342..1,142,746(-) | CR940352:1140342..1142746(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_187187 | 0 | 630 | 1893 | 74050 | 9.68 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA05020ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05020 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA05070 | TA05070-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 786 | TA05070 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 3864736 | Q4UBQ0 | 3 | CR940352:1,161,103..1,162,181(-) | CR940352:1161103..1162181(-) | CR940352 | Theileria annulata strain Ankara | 5 | OG6_113660 | 0 | 261 | 786 | 29414 | 9.75 | 0 | HMM: MPILRFVLILSSLVIHLSEESLGF, NN: MPILRFVLILSSLVIHLSEESLGF | NN Sum: 4, NN D: .7, HMM Prob: .99 | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05070ORATP-dependent Clp protease proteolytic subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05070 OR ATP-dependent Clp protease proteolytic subunit, putative AND Theileria annulata strain Ankara |
|
TA05610 | TA05610-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1875 | TA05610 | hypothetical protein, conserved | hypothetical protein, conserved | 3863522 | Q4UHM7 | 1 | tannA_chr01:1,449,226..1,451,158(+) | tannA_chr01:1449226..1451158(+) | tannA_chr01 | Theileria annulata strain Ankara | 0 | OG6_146093 | 2 | 624 | 1875 | 68838 | 5.74 | 0 | | | | | | | | | | | | | | | 2.7.4.21 (Inositol-hexakisphosphate kinase);2.7.4.24 (Diphosphoinositol-pentakisphosphate kinase) | 2.7.4.- (Phosphotransferases with a phosphate group as acceptor.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05610ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05610 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA05620 | TA05620-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 675 | TA05620 | hypothetical protein, conserved | hypothetical protein, conserved | 3863524 | Q4UHM9 | 1 | tannA_chr01:1,453,427..1,454,450(-) | tannA_chr01:1453427..1454450(-) | tannA_chr01 | Theileria annulata strain Ankara | 19 | OG6_119797 | 2 | 224 | 675 | 26071 | 8.31 | 0 | | | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05620ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05620 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA05625 | TA05625-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2112 | TA05625 | hypothetical protein, conserved | hypothetical protein, conserved | 3863525 | Q4UHN0 | 1 | tannA_chr01:1,455,013..1,457,375(-) | tannA_chr01:1455013..1457375(-) | tannA_chr01 | Theileria annulata strain Ankara | 0 | OG6_146093 | 2 | 703 | 2112 | 78063 | 8.87 | 0 | | | | | | | | | | | | | | | 2.7.4.21 (Inositol-hexakisphosphate kinase);2.7.4.24 (Diphosphoinositol-pentakisphosphate kinase) | 2.7.4.- (Phosphotransferases with a phosphate group as acceptor.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05625ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05625 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA05735 | TA05735-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 1302 | TA05735 | aspartyl protease, putative | aspartyl protease, putative | 3863549 | Q4UHZ1 | 1 | tannA_chr01:1,699,465..1,701,051(+) | tannA_chr01:1699465..1701051(+) | tannA_chr01 | Theileria annulata strain Ankara | 10 | OG6_139465 | 0 | 433 | 1302 | 49625 | 6.87 | 0 | HMM: MLLYYIIVFFVLSRTTIINCI, NN: MLLYYIIVFFVLSRTTIIN | NN Sum: 3, NN D: .65, HMM Prob: .69 | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05735ORaspartyl protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05735 OR aspartyl protease, putative AND Theileria annulata strain Ankara |
|
TA05950 | TA05950-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1317 | TA05950 | 26S proteasome subunit 4, putative | 26S proteasome subunit 4, putative | 3864293 | Q4UI30 | 1 | tannA_chr01:1,795,779..1,797,480(+) | tannA_chr01:1795779..1797480(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101477 | 0 | 438 | 1317 | 48959 | 5.66 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TA05950OR26S proteasome subunit 4, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA05950 OR 26S proteasome subunit 4, putative AND Theileria annulata strain Ankara |
|
TA06155 | TA06155-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 813 | TA06155 | 20S proteasome beta 5 subunit, putative | 20S proteasome beta 5 subunit, putative | 3863702 | Q4UI67 | 1 | tannA_chr01:1,866,385..1,867,488(-) | tannA_chr01:1866385..1867488(-) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_100897 | 0 | 270 | 813 | 30204 | 9.10 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA06155OR20S proteasome beta 5 subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA06155 OR 20S proteasome beta 5 subunit, putative AND Theileria annulata strain Ankara |
|
TA06255 | TA06255-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1308 | TA06255 | 26S proteasome subunit, putative | 26S proteasome subunit, putative | 3863456 | Q4UHP7 | 1 | tannA_chr01:1,500,384..1,502,133(+) | tannA_chr01:1500384..1502133(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101899 | 0 | 435 | 1308 | 48290 | 8.25 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TA06255OR26S proteasome subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA06255 OR 26S proteasome subunit, putative AND Theileria annulata strain Ankara |
|
TA06335 | TA06335-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 816 | TA06335 | proteasome subunit beta 7, putative | proteasome subunit beta 7, putative | 3864212 | Q4UIA0 | 1 | tannA_chr01:1,926,486..1,927,448(-) | tannA_chr01:1926486..1927448(-) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101382 | 0 | 271 | 816 | 29743 | 7.31 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA06335ORproteasome subunit beta 7, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA06335 OR proteasome subunit beta 7, putative AND Theileria annulata strain Ankara |
|
TA06755 | TA06755-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 594 | TA06755 | ubiquitin conjugating enzyme, putative | ubiquitin conjugating enzyme, putative | 3864004 | Q4UHS2 | 1 | tannA_chr01:1,558,973..1,559,796(+) | tannA_chr01:1558973..1559796(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_103192 | 0 | 197 | 594 | 22428 | 4.47 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=TA06755ORubiquitin conjugating enzyme, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA06755 OR ubiquitin conjugating enzyme, putative AND Theileria annulata strain Ankara |
|
TA06840 | TA06840-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2991 | TA06840 | hypothetical protein, conserved | hypothetical protein, conserved | 3863759 | Q4UHT9 | 1 | tannA_chr01:1,586,062..1,589,282(-) | tannA_chr01:1586062..1589282(-) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_105738 | 0 | 996 | 2991 | 115706 | 6.36 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=TA06840ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA06840 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA07050 | TA07050-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1008 | TA07050 | methionine aminopeptidase 1, putative | methionine aminopeptidase 1, putative | 3862611 | Q4UAM2 | 4 | CR940353:127,636..129,250(+) | CR940353:127636..129250(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_100342 | 0 | 335 | 1008 | 38042 | 7.27 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07050ORmethionine aminopeptidase 1, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07050 OR methionine aminopeptidase 1, putative AND Theileria annulata strain Ankara |
|
TA07090 | TA07090-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2493 | TA07090 | hypothetical protein, conserved | hypothetical protein, conserved | 3862657 | Q4UAC4 | 4 | CR940353:335,307..338,450(-) | CR940353:335307..338450(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101235 | 0 | 830 | 2493 | 93664 | 6.05 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07090ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07090 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA07095 | TA07095-t26_1 | 14 | 14 | 1 | | | forward | protein coding | No | 3453 | TA07095 | ClpB protein, putative | ClpB protein, putative | 3862658 | Q4UAC3 | 4 | CR940353:338,952..345,274(+) | CR940353:338952..345274(+) | CR940353 | Theileria annulata strain Ankara | 30 | OG6_100223 | 1 | 1150 | 3453 | 130630 | 8.55 | 0 | HMM: MWNLIIILLLKCVESF, NN: MWNLIIILLLKCVESF | NN Sum: 4, NN D: .82, HMM Prob: .94 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07095ORClpB protein, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07095 OR ClpB protein, putative AND Theileria annulata strain Ankara |
|
TA07380 | TA07380-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 897 | TA07380 | 26S proteasome (regulatory) subunit, putative | 26S proteasome (regulatory) subunit, putative | 3863083 | Q4UA69 | 4 | CR940353:474,892..476,154(+) | CR940353:474892..476154(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_102054 | 0 | 298 | 897 | 33884 | 6.35 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07380OR26S proteasome (regulatory) subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07380 OR 26S proteasome (regulatory) subunit, putative AND Theileria annulata strain Ankara |
|
TA07540 | TA07540-t26_1 | 10 | 10 | 1 | | | forward | protein coding | No | 2226 | TA07540 | eukaryotic translation initiation factor, putative | eukaryotic translation initiation factor, putative | 3862761 | Q4UA40 | 4 | CR940353:536,058..539,015(+) | CR940353:536058..539015(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101924 | 0 | 741 | 2226 | 86537 | 6.42 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003743;GO:0031369 | RNA binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07540OReukaryotic translation initiation factor, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07540 OR eukaryotic translation initiation factor, putative AND Theileria annulata strain Ankara |
|
TA07680 | TA07680-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1092 | TA07680 | glycoprotein endopeptidase, putative | glycoprotein endopeptidase, putative | 3862575 | Q4UA14 | 4 | CR940353:587,818..589,011(-) | CR940353:587818..589011(-) | CR940353 | Theileria annulata strain Ankara | 19 | OG6_100288 | 1 | 363 | 1092 | 40352 | 6.89 | 0 | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07680ORglycoprotein endopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07680 OR glycoprotein endopeptidase, putative AND Theileria annulata strain Ankara |
|
TA07800 | TA07800-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 3081 | TA07800 | transcription modulator, putative | transcription modulator, putative | 3862794 | Q4U9Z4 | 4 | CR940353:625,548..629,563(-) | CR940353:625548..629563(-) | CR940353 | Theileria annulata strain Ankara | 10 | OG6_102309 | 0 | 1026 | 3081 | 117827 | 4.68 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07800ORtranscription modulator, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07800 OR transcription modulator, putative AND Theileria annulata strain Ankara |
|
TA07815 | TA07815-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 600 | TA07815 | proteasome subunit, putative | proteasome subunit, putative | 3862797 | Q4U9Z1 | 4 | CR940353:632,204..633,114(-) | CR940353:632204..633114(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101631 | 0 | 199 | 600 | 22403 | 7.95 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA07815ORproteasome subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA07815 OR proteasome subunit, putative AND Theileria annulata strain Ankara |
|
TA08065 | TA08065-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 2319 | TA08065 | peptidase, putative | peptidase, putative | 3862987 | Q4U9U6 | 4 | CR940353:732,830..735,201(-) | CR940353:732830..735201(-) | CR940353 | Theileria annulata strain Ankara | 7 | OG6_102873 | 0 | 772 | 2319 | 88115 | 8.72 | 0 | | | | | GO:0004252;GO:0070008;GO:0008236 | serine-type endopeptidase activity;serine-type exopeptidase activity;serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08065ORpeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08065 OR peptidase, putative AND Theileria annulata strain Ankara |
|
TA08070 | TA08070-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 831 | TA08070 | proteasome subunit (alpha type 6 homologue), putative | proteasome subunit (alpha type 6 homologue), putative | 3862988 | Q4U9U5 | 4 | CR940353:735,486..736,596(+) | CR940353:735486..736596(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_102240 | 0 | 276 | 831 | 30518 | 5.85 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08070ORproteasome subunit (alpha type 6 homologue), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08070 OR proteasome subunit (alpha type 6 homologue), putative AND Theileria annulata strain Ankara |
|
TA08080 | TA08080-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 999 | TA08080 | hypothetical protein, conserved | hypothetical protein, conserved | 3862990 | Q4U9U3 | 4 | CR940353:738,327..739,484(-) | CR940353:738327..739484(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_102002 | 0 | 332 | 999 | 36448 | 4.68 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA08080ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08080 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA08465 | TA08465-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 963 | TA08465 | hypothetical protein, conserved | hypothetical protein, conserved | 3863068 | Q4U9M1 | 4 | CR940353:892,407..893,634(-) | CR940353:892407..893634(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_103242 | 0 | 320 | 963 | 36625 | 6.89 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08465ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08465 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA08510 | TA08510-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 222 | TA08510 | hypothetical protein | hypothetical protein | 3863077 | Q4U9L3 | 4 | CR940353:907,647..907,868(+) | CR940353:907647..907868(+) | CR940353 | Theileria annulata strain Ankara | 0 | OG6_244539 | 0 | 73 | 222 | 8112 | 4.45 | 0 | | | | | GO:0005524;GO:0003677;GO:0008094 | ATP binding;DNA binding;DNA-dependent ATPase activity | GO:0006281 | DNA repair | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA08510ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08510 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA08609 | TA08609-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 522 | TA08609 | signal peptidase, putative | signal peptidase, putative | 3863154 | Q4UAJ0 | 4 | CR940353:201,320..201,996(-) | CR940353:201320..201996(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_102447 | 0 | 173 | 522 | 20398 | 10.01 | 1 | HMM: MMNFLSRSYSVLHAGAMIGLIALFLNYYTGVNLR, NN: MMNFLSRSYSVLHAGAMIGLIALFLNYYTGV | NN Sum: 3, NN D: .56, HMM Prob: .16 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08609ORsignal peptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08609 OR signal peptidase, putative AND Theileria annulata strain Ankara |
|
TA08635 | TA08635-t26_1 | 15 | 15 | 1 | | | reverse | protein coding | No | 3606 | TA08635 | M16 peptidase, putative | M16 peptidase, putative | 3863160 | Q4U9J1 | 4 | CR940353:952,562..956,728(-) | CR940353:952562..956728(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_110270 | 0 | 1201 | 3606 | 138751 | 6.86 | 1 | HMM: MPVLFTFINNRSIILQSFTLLLFLINISQ, NN: MPVLFTFINNRSIILQSFTLLLFLINISQVHVI | NN Sum: 2, NN D: .51, HMM Prob: .2 | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08635ORM16 peptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08635 OR M16 peptidase, putative AND Theileria annulata strain Ankara |
|
TA08655 | TA08655-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3297 | TA08655 | hypothetical protein, conserved | hypothetical protein, conserved | 3863164 | Q4U9I7 | 4 | CR940353:964,719..968,015(-) | CR940353:964719..968015(-) | CR940353 | Theileria annulata strain Ankara | 13 | OG6_119794 | 0 | 1098 | 3297 | 123897 | 7.72 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08655ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08655 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA08700 | TA08700-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 705 | TA08700 | hypothetical protein, conserved | hypothetical protein, conserved | 3863173 | Q4U9H8 | 4 | CR940353:989,448..990,329(+) | CR940353:989448..990329(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_104384 | 0 | 234 | 705 | 27509 | 7.16 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA08700ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08700 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA08725 | TA08725-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 2076 | TA08725 | metallopeptidase, putative | metallopeptidase, putative | 3863178 | Q4U9H5 | 4 | CR940353:993,196..995,500(-) | CR940353:993196..995500(-) | CR940353 | Theileria annulata strain Ankara | 14 | OG6_101196 | 0 | 691 | 2076 | 77263 | 9.31 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08725ORmetallopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08725 OR metallopeptidase, putative AND Theileria annulata strain Ankara |
|
TA08760 | TA08760-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 405 | TA08760 | hypothetical protein, conserved | hypothetical protein, conserved | 3863185 | Q4U9G8 | 4 | CR940353:1,009,608..1,010,119(-) | CR940353:1009608..1010119(-) | CR940353 | Theileria annulata strain Ankara | 1 | OG6_103471 | 0 | 134 | 405 | 15201 | 9.11 | 0 | | | | | | | | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA08760ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA08760 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA09045 | TA09045-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1581 | TA09045 | cytosol aminopeptidase, putative | cytosol aminopeptidase, putative | 3863222 | Q4U9B7 | 4 | CR940353:1,122,190..1,124,147(+) | CR940353:1122190..1124147(+) | CR940353 | Theileria annulata strain Ankara | 11 | OG6_100682 | 0 | 526 | 1581 | 58484 | 6.08 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09045ORcytosol aminopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09045 OR cytosol aminopeptidase, putative AND Theileria annulata strain Ankara |
|
TA09310 | TA09310-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1347 | TA09310 | 26S proteasome ATPase subunit, putative | 26S proteasome ATPase subunit, putative | 3863274 | Q4UAE5 | 4 | CR940353:275,547..278,268(-) | CR940353:275547..278268(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101751 | 0 | 448 | 1347 | 50975 | 6.91 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09310OR26S proteasome ATPase subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09310 OR 26S proteasome ATPase subunit, putative AND Theileria annulata strain Ankara |
|
TA09390 | TA09390-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 816 | TA09390 | CLP protease, putative | CLP protease, putative | 3863290 | Q4UAC9 | 4 | CR940353:326,898..327,862(+) | CR940353:326898..327862(+) | CR940353 | Theileria annulata strain Ankara | 16 | OG6_100939 | 1 | 271 | 816 | 30616 | 9.18 | 0 | HMM: MNLNIILVDIFLIFVFKYSS, NN: MNLNIILVDIFLIFVFKYSSNK | NN Sum: 3, NN D: .56, HMM Prob: .01 | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09390ORCLP protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09390 OR CLP protease, putative AND Theileria annulata strain Ankara |
|
TA09495 | TA09495-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1848 | TA09495 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 3864672 | Q4UBX4 | 3 | CR940352:976,189..978,279(+) | CR940352:976189..978279(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_171502 | 0 | 615 | 1848 | 70745 | 9.01 | 0 | HMM: MYSIPLHLLILIPYILCL, NN: MYSIPLHLLILIPYILCL | NN Sum: 4, NN D: .76, HMM Prob: .77 | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09495ORmethionine aminopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09495 OR methionine aminopeptidase, putative AND Theileria annulata strain Ankara |
|
TA09615 | TA09615-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3969 | TA09615 | hypothetical protein | hypothetical protein | 3864078 | Q4UJ33 | 1 | tannA_chr01:2,528,669..2,532,637(+) | tannA_chr01:2528669..2532637(+) | tannA_chr01 | Theileria annulata strain Ankara | 43 | OG6_109345 | 27 | 1322 | 3969 | 149182 | 7.02 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA09615ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09615 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA09705 | TA09705-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1098 | TA09705 | hypothetical protein, conserved | hypothetical protein, conserved | 3864331 | Q4UJ51 | 1 | tannA_chr01:2,570,371..2,572,470(+) | tannA_chr01:2570371..2572470(+) | tannA_chr01 | Theileria annulata strain Ankara | 10 | OG6_101256 | 0 | 365 | 1098 | 41329 | 9.30 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09705ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09705 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA09880 | TA09880-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1665 | TA09880 | hypothetical protein, conserved | hypothetical protein, conserved | 3863100 | Q4U8N9 | 4 | CR940353:1,587,056..1,588,914(-) | CR940353:1587056..1588914(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_102601 | 0 | 554 | 1665 | 62470 | 7.04 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09880ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09880 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA09910 | TA09910-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 2751 | TA09910 | endopeptidase (CLP homologue) ATP-binding chain, putative | endopeptidase (CLP homologue) ATP-binding chain, putative | 3863106 | Q4U8P5 | 4 | CR940353:1,565,760..1,568,745(-) | CR940353:1565760..1568745(-) | CR940353 | Theileria annulata strain Ankara | 30 | OG6_100223 | 1 | 916 | 2751 | 102843 | 5.65 | 0 | HMM: MNIRRIHIYLFVILQAY, NN: MNIRRIHIYLFVILQAYNSL | NN Sum: 2, NN D: .56, HMM Prob: .03 | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TA09910ORendopeptidase (CLP homologue) ATP-binding chain, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA09910 OR endopeptidase (CLP homologue) ATP-binding chain, putative AND Theileria annulata strain Ankara |
|
TA10075 | TA10075-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 999 | TA10075 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 3863334 | Q4U8S5 | 4 | CR940353:1,504,721..1,505,956(-) | CR940353:1504721..1505956(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_124490 | 0 | 332 | 999 | 36806 | 7.46 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10075ORmethionine aminopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10075 OR methionine aminopeptidase, putative AND Theileria annulata strain Ankara |
|
TA10095 | TA10095-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1617 | TA10095 | ubiquitin C-terminal hydrolase, putative | ubiquitin C-terminal hydrolase, putative | 3863338 | Q4U8S7 | 4 | CR940353:1,501,258..1,503,100(-) | CR940353:1501258..1503100(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101892 | 0 | 538 | 1617 | 61120 | 5.35 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10095ORubiquitin C-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10095 OR ubiquitin C-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA10110 | TA10110-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 720 | TA10110 | hypothetical protein, conserved | hypothetical protein, conserved | 3863341 | Q4U8T0 | 4 | CR940353:1,496,333..1,497,249(+) | CR940353:1496333..1497249(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_113960 | 0 | 239 | 720 | 28004 | 5.54 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA10110ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10110 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA10245 | TA10245-t26_1 | 11 | 11 | 1 | | | reverse | protein coding | No | 2010 | TA10245 | peptidase, putative | peptidase, putative | 3862545 | Q4U8V5 | 4 | CR940353:1,443,028..1,445,450(-) | CR940353:1443028..1445450(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_100896 | 0 | 669 | 2010 | 76256 | 6.51 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10245ORpeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10245 OR peptidase, putative AND Theileria annulata strain Ankara |
|
TA10460 | TA10460-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 5139 | TA10460 | hypothetical protein, conserved | hypothetical protein, conserved | 3862676 | Q4U8Z4 | 4 | CR940353:1,368,487..1,373,798(-) | CR940353:1368487..1373798(-) | CR940353 | Theileria annulata strain Ankara | 26 | OG6_100915 | 1 | 1712 | 5139 | 199571 | 6.64 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10460ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10460 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA10605 | TA10605-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 2814 | TA10605 | hypothetical protein, conserved | hypothetical protein, conserved | 3862715 | Q4U920 | 4 | CR940353:1,313,319..1,316,270(+) | CR940353:1313319..1316270(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_103851 | 0 | 937 | 2814 | 108089 | 7.15 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10605ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10605 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA10875 | TA10875-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 663 | TA10875 | proteasome beta 3 subunit, putative | proteasome beta 3 subunit, putative | 3862831 | Q4U969 | 4 | CR940353:1,224,035..1,224,831(+) | CR940353:1224035..1224831(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101970 | 0 | 220 | 663 | 24265 | 4.83 | 0 | HMM: MVWRILILIYFHYNFGD, NN: MVWRILILIYFHYNFGD | NN Sum: 4, NN D: .68, HMM Prob: .15 | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA10875ORproteasome beta 3 subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10875 OR proteasome beta 3 subunit, putative AND Theileria annulata strain Ankara |
|
TA10955 | TA10955-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1788 | TA10955 | papain-family cysteine protease, putative | papain-family cysteine protease, putative | 3862847 | Q4U985 | 4 | CR940353:1,188,020..1,190,106(-) | CR940353:1188020..1190106(-) | CR940353 | Theileria annulata strain Ankara | 3 | OG6_244531 | 0 | 595 | 1788 | 68315 | 8.80 | 0 | HMM: MKVLLILANLVLIQGY, NN: MKVLLILANLVLIQGY | NN Sum: 3, NN D: .65, HMM Prob: .89 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA10955ORpapain-family cysteine protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA10955 OR papain-family cysteine protease, putative AND Theileria annulata strain Ankara |
|
TA11060 | TA11060-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 570 | TA11060 | hypothetical protein, conserved | hypothetical protein, conserved | 3862868 | Q4U8G2 | 4 | CR940353:1,752,775..1,753,479(+) | CR940353:1752775..1753479(+) | CR940353 | Theileria annulata strain Ankara | 8 | OG6_102074 | 0 | 189 | 570 | 21691 | 7.64 | 2 | | | | | | | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11060ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11060 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA11130 | TA11130-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1701 | TA11130 | ubiquitin-like protease (Ul), putative | ubiquitin-like protease (Ul), putative | 3862882 | Q4U8H6 | 4 | CR940353:1,718,516..1,720,475(+) | CR940353:1718516..1720475(+) | CR940353 | Theileria annulata strain Ankara | 4 | OG6_140580 | 0 | 566 | 1701 | 66903 | 5.80 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA11130ORubiquitin-like protease (Ul), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11130 OR ubiquitin-like protease (Ul), putative AND Theileria annulata strain Ankara |
|
TA11230 | TA11230-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1893 | TA11230 | glycoprotease, putative | glycoprotease, putative | 3862902 | Q4U8J6 | 4 | CR940353:1,673,203..1,675,374(+) | CR940353:1673203..1675374(+) | CR940353 | Theileria annulata strain Ankara | 19 | OG6_100288 | 1 | 630 | 1893 | 72592 | 8.35 | 1 | HMM: MKFLIISTCILFVCNYCK, NN: MKFLIISTCILFVCNYCKFSY | NN Sum: 2, NN D: .44, HMM Prob: .63 | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11230ORglycoprotease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11230 OR glycoprotease, putative AND Theileria annulata strain Ankara |
|
TA11345 | TA11345-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 711 | TA11345 | proteasome subunit, putative | proteasome subunit, putative | 3862925 | Q4U8L9 | 4 | CR940353:1,636,545..1,637,708(+) | CR940353:1636545..1637708(+) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101207 | 0 | 236 | 711 | 26182 | 8.03 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11345ORproteasome subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11345 OR proteasome subunit, putative AND Theileria annulata strain Ankara |
|
TA11350 | TA11350-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 765 | TA11350 | proteasome subunit, putative | proteasome subunit, putative | 3862926 | Q4U8M0 | 4 | CR940353:1,635,198..1,636,165(-) | CR940353:1635198..1636165(-) | CR940353 | Theileria annulata strain Ankara | 9 | OG6_101968 | 0 | 254 | 765 | 28289 | 5.38 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11350ORproteasome subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11350 OR proteasome subunit, putative AND Theileria annulata strain Ankara |
|
TA11460 | TA11460-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 630 | TA11460 | hypothetical protein, conserved | hypothetical protein, conserved | 3862358 | Q4UDI1 | 2 | CR940348:1,720,556..1,721,362(+) | CR940348:1720556..1721362(+) | CR940348 | Theileria annulata strain Ankara | 8 | OG6_101672 | 0 | 209 | 630 | 24113 | 7.44 | 5 | HMM: MDSIIGPIPFMTRIYLSTSVFLMILCSLDIISPL, NN: MDSIIGPIPFMTRIYLSTSVFLMILCSLDIISPL | NN Sum: 2, NN D: .53, HMM Prob: .06 | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA11460ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11460 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA11510 | TA11510-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 1218 | TA11510 | DNA-damage inducible protein ddi1-like, putative | DNA-damage inducible protein ddi1-like, putative | 3862368 | Q4UDI9 | 2 | CR940348:1,704,797..1,706,243(+) | CR940348:1704797..1706243(+) | CR940348 | Theileria annulata strain Ankara | 6 | OG6_101685 | 0 | 405 | 1218 | 45834 | 4.70 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11510ORDNA-damage inducible protein ddi1-like, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11510 OR DNA-damage inducible protein ddi1-like, putative AND Theileria annulata strain Ankara |
|
TA11565 | TA11565-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1242 | TA11565 | cysteine proteinase, putative | cysteine proteinase, putative | 3861878 | Q4UDK0 | 2 | CR940348:1,685,503..1,686,744(+) | CR940348:1685503..1686744(+) | CR940348 | Theileria annulata strain Ankara | 34 | OG6_100116 | 7 | 413 | 1242 | 47069 | 7.92 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11565ORcysteine proteinase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11565 OR cysteine proteinase, putative AND Theileria annulata strain Ankara |
|
TA11690 | TA11690-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 4548 | TA11690 | hypothetical protein, conserved | hypothetical protein, conserved | 3861690 | Q4UDM2 | 2 | CR940348:1,629,967..1,634,703(+) | CR940348:1629967..1634703(+) | CR940348 | Theileria annulata strain Ankara | 14 | OG6_126374 | 0 | 1515 | 4548 | 176299 | 8.21 | 1 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11690ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11690 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA11805 | TA11805-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1479 | TA11805 | erythrocyte membrane-associated malaria antigen-like | erythrocyte membrane-associated malaria antigen-like | 3862428 | Q4UDP3 | 2 | CR940348:1,579,945..1,581,795(+) | CR940348:1579945..1581795(+) | CR940348 | Theileria annulata strain Ankara | 11 | OG6_124535 | 0 | 492 | 1479 | 55911 | 7.36 | 1 | HMM: MVINFSRTLTLYFWLFYRIILIIRAE, NN: MVINFSRTLTLYFWLFYRIILIIRAE | NN Sum: 4, NN D: .79, HMM Prob: .48 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11805ORerythrocyte membrane-associated malaria antigen-likeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11805 OR erythrocyte membrane-associated malaria antigen-like AND Theileria annulata strain Ankara |
|
TA11850 | TA11850-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 939 | TA11850 | proteasome regulatory subunit, putative | proteasome regulatory subunit, putative | 3862398 | Q4UDQ1 | 2 | CR940348:1,563,589..1,564,838(+) | CR940348:1563589..1564838(+) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_101835 | 0 | 312 | 939 | 35264 | 7.27 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11850ORproteasome regulatory subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11850 OR proteasome regulatory subunit, putative AND Theileria annulata strain Ankara |
|
TA11975 | TA11975-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1578 | TA11975 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | 3861979 | Q4UDS4 | 2 | CR940348:1,523,935..1,525,784(+) | CR940348:1523935..1525784(+) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102381 | 0 | 525 | 1578 | 59044 | 6.68 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA11975ORmitochondrial processing peptidase alpha subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA11975 OR mitochondrial processing peptidase alpha subunit, putative AND Theileria annulata strain Ankara |
|
TA12030 | TA12030-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 525 | TA12030 | hypothetical protein, conserved | hypothetical protein, conserved | 3862030 | Q4UDT4 | 2 | CR940348:1,506,852..1,507,672(-) | CR940348:1506852..1507672(-) | CR940348 | Theileria annulata strain Ankara | 10 | OG6_104644 | 1 | 174 | 525 | 20071 | 5.08 | 0 | | | | | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12030ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12030 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA12175 | TA12175-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3360 | TA12175 | falcilysin-related protein, putative | falcilysin-related protein, putative | 3861940 | Q4UDW1 | 2 | CR940348:1,453,503..1,456,862(+) | CR940348:1453503..1456862(+) | CR940348 | Theileria annulata strain Ankara | 10 | OG6_101809 | 1 | 1119 | 3360 | 129383 | 8.29 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12175ORfalcilysin-related protein, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12175 OR falcilysin-related protein, putative AND Theileria annulata strain Ankara |
|
TA12185 | TA12185-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3546 | TA12185 | falcilysin, putative | falcilysin, putative | 3861942 | Q4UDW3 | 2 | CR940348:1,445,631..1,449,176(+) | CR940348:1445631..1449176(+) | CR940348 | Theileria annulata strain Ankara | 10 | OG6_101809 | 1 | 1181 | 3546 | 135433 | 6.35 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12185ORfalcilysin, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12185 OR falcilysin, putative AND Theileria annulata strain Ankara |
|
TA12220 | TA12220-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 3231 | TA12220 | hypothetical protein, conserved | hypothetical protein, conserved | 3862049 | Q4UDW9 | 2 | CR940348:1,434,384..1,437,904(+) | CR940348:1434384..1437904(+) | CR940348 | Theileria annulata strain Ankara | 11 | OG6_156430 | 0 | 1076 | 3231 | 125049 | 8.79 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA12220ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12220 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA12400 | TA12400-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 474 | TA12400 | hypothetical protein, conserved | hypothetical protein, conserved | 3862448 | Q4UE00 | 2 | CR940348:1,373,305..1,373,984(-) | CR940348:1373305..1373984(-) | CR940348 | Theileria annulata strain Ankara | 8 | OG6_102356 | 0 | 157 | 474 | 18427 | 8.94 | 0 | | | | | | | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12400ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12400 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA12615 | TA12615-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 381 | TA12615 | autophagy protein 8I, putative | autophagy protein 8I, putative | 3862264 | Q4UE40 | 2 | CR940348:1,296,192..1,296,681(-) | CR940348:1296192..1296681(-) | CR940348 | Theileria annulata strain Ankara | 8 | OG6_100707 | 0 | 126 | 381 | 14862 | 9.00 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA12615ORautophagy protein 8I, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12615 OR autophagy protein 8I, putative AND Theileria annulata strain Ankara |
|
TA12645 | TA12645-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1899 | TA12645 | ubiquitin carboxy-terminal hydrolase, putative | ubiquitin carboxy-terminal hydrolase, putative | 3862270 | Q4UE45 | 2 | CR940348:1,287,968..1,289,866(+) | CR940348:1287968..1289866(+) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_101457 | 0 | 632 | 1899 | 73054 | 8.56 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12645ORubiquitin carboxy-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12645 OR ubiquitin carboxy-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA12685 | TA12685-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 3798 | TA12685 | ABC1-related protein, putative | ABC1-related protein, putative | 3862278 | Q4UE53 | 2 | CR940348:1,274,052..1,277,938(+) | CR940348:1274052..1277938(+) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_112296 | 0 | 1265 | 3798 | 146952 | 5.10 | 0 | | | | | GO:0005524;GO:0004672 | ATP binding;protein kinase activity | GO:0006468 | protein phosphorylation | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12685ORABC1-related protein, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12685 OR ABC1-related protein, putative AND Theileria annulata strain Ankara |
|
TA12710 | TA12710-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 972 | TA12710 | hydrolase, putative | hydrolase, putative | 3862126 | Q4UE56 | 2 | CR940348:1,268,932..1,270,087(-) | CR940348:1268932..1270087(-) | CR940348 | Theileria annulata strain Ankara | 10 | OG6_110414 | 0 | 323 | 972 | 36202 | 8.56 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12710ORhydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12710 OR hydrolase, putative AND Theileria annulata strain Ankara |
|
TA12745 | TA12745-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3312 | TA12745 | Lon protease homolog 2, mitochondrial precursor, putative | Lon protease homolog 2, mitochondrial precursor, putative | 3862133 | Q4UE63 | 2 | CR940348:1,256,651..1,259,962(-) | CR940348:1256651..1259962(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_100411 | 0 | 1103 | 3312 | 123017 | 6.65 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=TA12745ORLon protease homolog 2, mitochondrial precursor, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA12745 OR Lon protease homolog 2, mitochondrial precursor, putative AND Theileria annulata strain Ankara |
|
TA13125 | TA13125-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 2457 | TA13125 | mitochondrial respiratory chain complexes assembly protein (AFG3 homologue), putative | mitochondrial respiratory chain complexes assembly protein (AFG3 homologue), putative | 3862073 | Q4UED3 | 2 | CR940348:1,124,216..1,126,796(+) | CR940348:1124216..1126796(+) | CR940348 | Theileria annulata strain Ankara | 13 | OG6_100384 | 1 | 818 | 2457 | 92228 | 8.52 | 0 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13125ORmitochondrial respiratory chain complexes assembly protein (AFG3 homologue), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13125 OR mitochondrial respiratory chain complexes assembly protein (AFG3 homologue), putative AND Theileria annulata strain Ankara |
|
TA13475 | TA13475-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1122 | TA13475 | hypothetical protein, conserved | hypothetical protein, conserved | 3861966 | Q4UEJ5 | 2 | CR940348:1,008,063..1,009,238(-) | CR940348:1008063..1009238(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102202 | 0 | 373 | 1122 | 43093 | 4.52 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13475ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13475 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA13550 | TA13550-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1053 | TA13550 | autophagy-related peptidase, putative | autophagy-related peptidase, putative | 3862463 | Q4UEL0 | 2 | CR940348:972,375..973,705(+) | CR940348:972375..973705(+) | CR940348 | Theileria annulata strain Ankara | 7 | OG6_100501 | 0 | 350 | 1053 | 41040 | 9.45 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13550ORautophagy-related peptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13550 OR autophagy-related peptidase, putative AND Theileria annulata strain Ankara |
|
TA13865 | TA13865-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 885 | TA13865 | proteasome subunit y, putative | proteasome subunit y, putative | 3861810 | Q4UER7 | 2 | CR940348:860,455..861,484(-) | CR940348:860455..861484(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_101390 | 0 | 294 | 885 | 33224 | 5.91 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13865ORproteasome subunit y, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13865 OR proteasome subunit y, putative AND Theileria annulata strain Ankara |
|
TA13875 | TA13875-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 2022 | TA13875 | hypothetical protein, conserved | hypothetical protein, conserved | 3861812 | Q4UER9 | 2 | CR940348:855,699..858,695(-) | CR940348:855699..858695(-) | CR940348 | Theileria annulata strain Ankara | 2 | OG6_244266 | 0 | 673 | 2022 | 76819 | 9.87 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13875ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13875 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA13905 | TA13905-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 1821 | TA13905 | hypothetical protein, conserved | hypothetical protein, conserved | 3861915 | Q4UES4 | 2 | CR940348:843,754..846,896(+) | CR940348:843754..846896(+) | CR940348 | Theileria annulata strain Ankara | 13 | OG6_126349 | 0 | 606 | 1821 | 68925 | 9.90 | 8 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TA13905ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA13905 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA14360 | TA14360-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1380 | TA14360 | hydrolase, putative | hydrolase, putative | 3861648 | Q4UF06 | 2 | CR940348:691,850..693,358(+) | CR940348:691850..693358(+) | CR940348 | Theileria annulata strain Ankara | 8 | OG6_129556 | 0 | 459 | 1380 | 51236 | 7.76 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA14360ORhydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA14360 OR hydrolase, putative AND Theileria annulata strain Ankara |
|
TA14855 | TA14855-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 549 | TA14855 | hypothetical protein, conserved | hypothetical protein, conserved | 3862301 | Q4UF95 | 2 | CR940348:509,790..510,584(-) | CR940348:509790..510584(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102788 | 0 | 182 | 549 | 21495 | 5.04 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA14855ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA14855 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA15335 | TA15335-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1737 | TA15335 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3861753 | Q4UFF9 | 2 | CR940348:320,764..323,366(+) | CR940348:320764..323366(+) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102786 | 0 | 578 | 1737 | 65239 | 9.47 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15335ORubiquitin carboxyl-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15335 OR ubiquitin carboxyl-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA15660 | TA15660-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1464 | TA15660 | cysteine protease, putative | cysteine protease, putative | 3862110 | Q4UDG1 | 2 | CR940348:1,761,772..1,763,291(+) | CR940348:1761772..1763291(+) | CR940348 | Theileria annulata strain Ankara | 22 | OG6_138505 | 1 | 487 | 1464 | 56714 | 8.13 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15660ORcysteine protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15660 OR cysteine protease, putative AND Theileria annulata strain Ankara |
|
TA15665 | TA15665-t26_1 | 11 | 11 | 1 | | | forward | protein coding | No | 2379 | TA15665 | cathepsin-like cysteine protease, putative | cathepsin-like cysteine protease, putative | 3862111 | Q4UFL9 | 2 | CR940348:190,929..194,347(+) | CR940348:190929..194347(+) | CR940348 | Theileria annulata strain Ankara | 17 | OG6_103622 | 1 | 792 | 2379 | 90190 | 6.51 | 0 | HMM: MLFKVCKLKYFILLFIIIISHVKLD, NN: MLFKVCKLKYFILLFIIIISHVKLD | NN Sum: 4, NN D: .74, HMM Prob: .49 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15665ORcathepsin-like cysteine protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15665 OR cathepsin-like cysteine protease, putative AND Theileria annulata strain Ankara |
|
TA15700 | TA15700-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1182 | TA15700 | 26S proteasome ATPase subunit (Rpt6A homologue), putative | 26S proteasome ATPase subunit (Rpt6A homologue), putative | 3862118 | Q4UFM6 | 2 | CR940348:175,343..176,524(-) | CR940348:175343..176524(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_101513 | 0 | 393 | 1182 | 44121 | 7.00 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15700OR26S proteasome ATPase subunit (Rpt6A homologue), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15700 OR 26S proteasome ATPase subunit (Rpt6A homologue), putative AND Theileria annulata strain Ankara |
|
TA15715 | TA15715-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 1743 | TA15715 | cysteine protease, putative | cysteine protease, putative | 3862121 | Q4UDG2 | 2 | CR940348:1,759,574..1,761,384(+) | CR940348:1759574..1761384(+) | CR940348 | Theileria annulata strain Ankara | 22 | OG6_138505 | 1 | 580 | 1743 | 66661 | 8.41 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 1.3.1.74 (2-alkenal reductase (NAD(P)(+))) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15715ORcysteine protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15715 OR cysteine protease, putative AND Theileria annulata strain Ankara |
|
TA15870 | TA15870-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1377 | TA15870 | metallo-protease, putative | metallo-protease, putative | 3861859 | Q4UFQ7 | 2 | CR940348:109,869..111,446(-) | CR940348:109869..111446(-) | CR940348 | Theileria annulata strain Ankara | 4 | OG6_223473 | 1 | 458 | 1377 | 53200 | 10.09 | 4 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA15870ORmetallo-protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15870 OR metallo-protease, putative AND Theileria annulata strain Ankara |
|
TA15875 | TA15875-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 720 | TA15875 | proteasome subunit alpha type 1, putative | proteasome subunit alpha type 1, putative | 3861860 | | 2 | CR940348:108,362..109,448(-) | CR940348:108362..109448(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102143 | 1 | 239 | 720 | 26376 | 7.97 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15875ORproteasome subunit alpha type 1, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15875 OR proteasome subunit alpha type 1, putative AND Theileria annulata strain Ankara |
|
TA15890 | TA15890-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1317 | TA15890 | metallo-protease, putative | metallo-protease, putative | 3861863 | Q4UFQ9 | 2 | CR940348:106,644..108,180(-) | CR940348:106644..108180(-) | CR940348 | Theileria annulata strain Ankara | 12 | OG6_101632 | 0 | 438 | 1317 | 51597 | 9.25 | 6 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15890ORmetallo-protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15890 OR metallo-protease, putative AND Theileria annulata strain Ankara |
|
TA15895 | TA15895-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1344 | TA15895 | metallo-protease, putative | metallo-protease, putative | 3861864 | Q4UFR0 | 2 | CR940348:104,652..106,197(-) | CR940348:104652..106197(-) | CR940348 | Theileria annulata strain Ankara | 4 | OG6_223473 | 1 | 447 | 1344 | 52200 | 10.22 | 5 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA15895ORmetallo-protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15895 OR metallo-protease, putative AND Theileria annulata strain Ankara |
|
TA15900 | TA15900-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 720 | TA15900 | proteasome subunit alpha type 1, putative | proteasome subunit alpha type 1, putative | 3861865 | | 2 | CR940348:103,157..104,250(-) | CR940348:103157..104250(-) | CR940348 | Theileria annulata strain Ankara | 9 | OG6_102143 | 1 | 239 | 720 | 26376 | 7.97 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA15900ORproteasome subunit alpha type 1, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA15900 OR proteasome subunit alpha type 1, putative AND Theileria annulata strain Ankara |
|
TA16070 | TA16070-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1149 | TA16070 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3862310 | Q4UDH1 | 2 | CR940348:1,744,073..1,745,315(+) | CR940348:1744073..1745315(+) | CR940348 | Theileria annulata strain Ankara | 7 | OG6_101733 | 0 | 382 | 1149 | 43537 | 6.75 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA16070ORubiquitin carboxyl-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA16070 OR ubiquitin carboxyl-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA16115 | TA16115-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 456 | TA16115 | mitochondrial membrane protease, subunit 2, putative | mitochondrial membrane protease, subunit 2, putative | 3864133 | Q4UIG5 | 1 | tannA_chr01:2,052,169..2,052,771(-) | tannA_chr01:2052169..2052771(-) | tannA_chr01 | Theileria annulata strain Ankara | 8 | OG6_100609 | 0 | 151 | 456 | 17133 | 10.12 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TA16115ORmitochondrial membrane protease, subunit 2, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA16115 OR mitochondrial membrane protease, subunit 2, putative AND Theileria annulata strain Ankara |
|
TA16460 | TA16460-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 2418 | TA16460 | metalloprotease/cell division cycle protein (FtsH homologue), putative | metalloprotease/cell division cycle protein (FtsH homologue), putative | 3864066 | Q4UIW8 | 1 | tannA_chr01:2,365,623..2,368,169(-) | tannA_chr01:2365623..2368169(-) | tannA_chr01 | Theileria annulata strain Ankara | 13 | OG6_100384 | 1 | 805 | 2418 | 89407 | 4.68 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA16460ORmetalloprotease/cell division cycle protein (FtsH homologue), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA16460 OR metalloprotease/cell division cycle protein (FtsH homologue), putative AND Theileria annulata strain Ankara |
|
TA16610 | TA16610-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 1437 | TA16610 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | 3864019 | Q4UIZ5 | 1 | tannA_chr01:2,429,496..2,431,445(-) | tannA_chr01:2429496..2431445(-) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_102047 | 0 | 478 | 1437 | 52873 | 6.63 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.- (Aminopeptidases.) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA16610ORaspartyl aminopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA16610 OR aspartyl aminopeptidase, putative AND Theileria annulata strain Ankara |
|
TA16975 | TA16975-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 648 | TA16975 | ATP-dependent Clp-like protease, putative | ATP-dependent Clp-like protease, putative | 3863387 | Q4UIN3 | 1 | tannA_chr01:2,191,650..2,192,445(+) | tannA_chr01:2191650..2192445(+) | tannA_chr01 | Theileria annulata strain Ankara | 16 | OG6_100939 | 1 | 215 | 648 | 24363 | 5.96 | 0 | | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=TA16975ORATP-dependent Clp-like protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA16975 OR ATP-dependent Clp-like protease, putative AND Theileria annulata strain Ankara |
|
TA17225 | TA17225-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1191 | TA17225 | 26s protease regulatory subunit, putative | 26s protease regulatory subunit, putative | 3862601 | Q4UAQ2 | 4 | CR940353:79,079..80,773(+) | CR940353:79079..80773(+) | CR940353 | Theileria annulata strain Ankara | 8 | OG6_101965 | 0 | 396 | 1191 | 44739 | 6.73 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TA17225OR26s protease regulatory subunit, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA17225 OR 26s protease regulatory subunit, putative AND Theileria annulata strain Ankara |
|
TA17285 | TA17285-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2973 | TA17285 | lysophospholipase-like protein, putative | lysophospholipase-like protein, putative | 3863357 | Q4UAP0 | 4 | CR940353:97,790..100,762(-) | CR940353:97790..100762(-) | CR940353 | Theileria annulata strain Ankara | 2 | OG6_244171 | 0 | 990 | 2973 | 115278 | 9.78 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA17285ORlysophospholipase-like protein, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA17285 OR lysophospholipase-like protein, putative AND Theileria annulata strain Ankara |
|
TA17465 | TA17465-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1218 | TA17465 | GPI anchor transamidase, putative | GPI anchor transamidase, putative | 3864577 | Q4UAV9 | 3 | CR940352:1,818,638..1,820,200(+) | CR940352:1818638..1820200(+) | CR940352 | Theileria annulata strain Ankara | 8 | OG6_101767 | 0 | 405 | 1218 | 47094 | 9.66 | 0 | | | | | GO:0008233 | peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA17465ORGPI anchor transamidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA17465 OR GPI anchor transamidase, putative AND Theileria annulata strain Ankara |
|
TA17680 | TA17680-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3672 | TA17680 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 3865355 | Q4UBA6 | 3 | CR940352:1,471,212..1,474,910(-) | CR940352:1471212..1474910(-) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_129339 | 0 | 1223 | 3672 | 141109 | 6.37 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA17680ORubiquitin carboxyl-terminal hydrolase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA17680 OR ubiquitin carboxyl-terminal hydrolase, putative AND Theileria annulata strain Ankara |
|
TA17685 | TA17685-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1374 | TA17685 | aspartyl(acid) protease, putative | aspartyl(acid) protease, putative | 3865356 | Q4UBA5 | 3 | CR940352:1,475,894..1,477,360(+) | CR940352:1475894..1477360(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_107443 | 0 | 457 | 1374 | 52200 | 7.76 | 0 | HMM: MLLNKFLYISYIFILLMIQFPKLSHLG, NN: MLLNKFLYISYIFILLMIQFPKLSHLG | NN Sum: 2, NN D: .58, HMM Prob: .16 | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA17685ORaspartyl(acid) protease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA17685 OR aspartyl(acid) protease, putative AND Theileria annulata strain Ankara |
|
TA18005 | TA18005-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 2307 | TA18005 | hypothetical protein | hypothetical protein | 3864927 | Q4UB48 | 3 | CR940352:1,574,584..1,576,988(+) | CR940352:1574584..1576988(+) | CR940352 | Theileria annulata strain Ankara | 181 | OG6_100231 | 2 | 768 | 2307 | 89752 | 7.83 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18005ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18005 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA18080 | TA18080-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1269 | TA18080 | Possible rhomboid family protein | Possible rhomboid family protein | 3864647 | Q4UB35 | 3 | CR940352:1,622,365..1,623,633(+) | CR940352:1622365..1623633(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_150993 | 0 | 422 | 1269 | 48676 | 9.82 | 4 | HMM: MLPSISLLQFIFILVATELI, NN: MLPSISLLQFIFILVATELIKCF | NN Sum: 4, NN D: .71, HMM Prob: .96 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18080ORPossible rhomboid family proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18080 OR Possible rhomboid family protein AND Theileria annulata strain Ankara |
|
TA18145 | TA18145-t26_1 | 8 | 8 | 1 | | | reverse | protein coding | No | 954 | TA18145 | hypothetical protein | hypothetical protein | 3864719 | Q4UB22 | 3 | CR940352:1,658,386..1,659,741(-) | CR940352:1658386..1659741(-) | CR940352 | Theileria annulata strain Ankara | 3 | OG6_244280 | 0 | 317 | 954 | 36203 | 4.49 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA18145ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18145 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA18155 | TA18155-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1593 | TA18155 | protease, putative | protease, putative | 3864721 | Q4UB20 | 3 | CR940352:1,660,376..1,662,034(-) | CR940352:1660376..1662034(-) | CR940352 | Theileria annulata strain Ankara | 8 | OG6_112025 | 0 | 530 | 1593 | 60752 | 9.82 | 7 | HMM: MNKYGRWLKFVFISVFYWIHLQQCVTI, NN: MNKYGRWLKFVFISVFYWIHLQQCVTI | NN Sum: 4, NN D: .72, HMM Prob: .62 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA18155ORprotease, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18155 OR protease, putative AND Theileria annulata strain Ankara |
|
TA18250 | TA18250-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 552 | TA18250 | hypothetical protein | hypothetical protein | 3865048 | Q4UB03 | 3 | CR940352:1,704,954..1,705,720(+) | CR940352:1704954..1705720(+) | CR940352 | Theileria annulata strain Ankara | 8 | OG6_194667 | 0 | 183 | 552 | 21561 | 9.87 | 2 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA18250ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18250 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA18300 | TA18300-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 552 | TA18300 | signal peptidase, putative | signal peptidase, putative | 3865058 | Q4UAZ5 | 3 | CR940352:1,722,327..1,722,964(+) | CR940352:1722327..1722964(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_100807 | 0 | 183 | 552 | 20834 | 9.59 | 2 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18300ORsignal peptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18300 OR signal peptidase, putative AND Theileria annulata strain Ankara |
|
TA18320 | TA18320-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 711 | TA18320 | proteasome subunit alpha type 2, putative | proteasome subunit alpha type 2, putative | 3865140 | Q4UAZ2 | 3 | CR940352:1,727,558..1,728,491(-) | CR940352:1727558..1728491(-) | CR940352 | Theileria annulata strain Ankara | 8 | OG6_101969 | 0 | 236 | 711 | 25696 | 4.53 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18320ORproteasome subunit alpha type 2, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18320 OR proteasome subunit alpha type 2, putative AND Theileria annulata strain Ankara |
|
TA18476 | TA18476-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3801 | TA18476 | hypothetical protein, conserved | hypothetical protein, conserved | 3864315 | Q4UHM5 | 1 | tannA_chr01:1,442,686..1,446,486(-) | tannA_chr01:1442686..1446486(-) | tannA_chr01 | Theileria annulata strain Ankara | 0 | OG6_146093 | 2 | 1266 | 3801 | 140537 | 5.40 | 0 | | | | | | | | | | | | | | | 2.7.4.21 (Inositol-hexakisphosphate kinase);2.7.4.24 (Diphosphoinositol-pentakisphosphate kinase) | 2.7.4.- (Phosphotransferases with a phosphate group as acceptor.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18476ORhypothetical protein, conservedANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18476 OR hypothetical protein, conserved AND Theileria annulata strain Ankara |
|
TA18485 | TA18485-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1302 | TA18485 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 3864770 | Q4UBJ1 | 3 | CR940352:1,287,720..1,289,369(+) | CR940352:1287720..1289369(+) | CR940352 | Theileria annulata strain Ankara | 9 | OG6_100815 | 0 | 433 | 1302 | 48831 | 6.44 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA18485ORmethionine aminopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA18485 OR methionine aminopeptidase, putative AND Theileria annulata strain Ankara |
|
TA19130 | TA19130-t26_1 | 12 | 12 | 1 | | | forward | protein coding | No | 1554 | TA19130 | mitochondrial processing peptidase, putative | mitochondrial processing peptidase, putative | 3863776 | Q4UGA3 | 1 | tannA_chr01:325,855..328,162(+) | tannA_chr01:325855..328162(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_100777 | 0 | 517 | 1554 | 58882 | 6.85 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA19130ORmitochondrial processing peptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA19130 OR mitochondrial processing peptidase, putative AND Theileria annulata strain Ankara |
|
TA19315 | TA19315-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 639 | TA19315 | proteasome subunit beta type 2, putative | proteasome subunit beta type 2, putative | 3864485 | Q4UGD6 | 1 | tannA_chr01:394,558..395,291(+) | tannA_chr01:394558..395291(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_102061 | 0 | 212 | 639 | 24308 | 6.60 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA19315ORproteasome subunit beta type 2, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA19315 OR proteasome subunit beta type 2, putative AND Theileria annulata strain Ankara |
|
TA20200 | TA20200-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 765 | TA20200 | proteasome subunit alpha type 5-2, putative | proteasome subunit alpha type 5-2, putative | 3864231 | Q4UHB7 | 1 | tannA_chr01:1,177,856..1,179,012(+) | tannA_chr01:1177856..1179012(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101621 | 0 | 254 | 765 | 28177 | 4.42 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20200ORproteasome subunit alpha type 5-2, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20200 OR proteasome subunit alpha type 5-2, putative AND Theileria annulata strain Ankara |
|
TA20250 | TA20250-t26_1 | 14 | 14 | 1 | | | reverse | protein coding | No | 2277 | TA20250 | hypothetical protein | hypothetical protein | 3864241 | Q4UHA7 | 1 | tannA_chr01:1,144,388..1,148,690(-) | tannA_chr01:1144388..1148690(-) | tannA_chr01 | Theileria annulata strain Ankara | 10 | OG6_104644 | 1 | 758 | 2277 | 86034 | 8.99 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20250ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20250 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA20475 | TA20475-t26_1 | 15 | 15 | 1 | | | reverse | protein coding | No | 2352 | TA20475 | endopeptidase, putative | endopeptidase, putative | 3863506 | Q4UH62 | 1 | tannA_chr01:1,048,581..1,051,459(-) | tannA_chr01:1048581..1051459(-) | tannA_chr01 | Theileria annulata strain Ankara | 12 | OG6_102110 | 0 | 783 | 2352 | 92618 | 7.02 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20475ORendopeptidase, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20475 OR endopeptidase, putative AND Theileria annulata strain Ankara |
|
TA20680 | TA20680-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1536 | TA20680 | integral membrane protein, rhomboid family | integral membrane protein, rhomboid family | 3863945 | Q4UH21 | 1 | tannA_chr01:949,581..951,213(+) | tannA_chr01:949581..951213(+) | tannA_chr01 | Theileria annulata strain Ankara | 11 | OG6_124366 | 0 | 511 | 1536 | 58768 | 9.75 | 3 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20680ORintegral membrane protein, rhomboid familyANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20680 OR integral membrane protein, rhomboid family AND Theileria annulata strain Ankara |
|
TA20685 | TA20685-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 282 | TA20685 | hypothetical protein | hypothetical protein | 3863946 | Q4UH20 | 1 | tannA_chr01:948,889..949,237(+) | tannA_chr01:948889..949237(+) | tannA_chr01 | Theileria annulata strain Ankara | 8 | OG6_194527 | 0 | 93 | 282 | 10866 | 10.66 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=TA20685ORhypothetical proteinANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20685 OR hypothetical protein AND Theileria annulata strain Ankara |
|
TA20910 | TA20910-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 2922 | TA20910 | aminopeptidase n, putative | aminopeptidase n, putative | 3863820 | Q4UGX3 | 1 | tannA_chr01:807,485..810,494(+) | tannA_chr01:807485..810494(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_106799 | 0 | 973 | 2922 | 111550 | 6.61 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.- (Aminopeptidases.);3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20910ORaminopeptidase n, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20910 OR aminopeptidase n, putative AND Theileria annulata strain Ankara |
|
TA20965 | TA20965-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1317 | TA20965 | rhomboid family integral membrane protein, putative | rhomboid family integral membrane protein, putative | 3863715 | Q4UGW3 | 1 | tannA_chr01:779,679..781,090(-) | tannA_chr01:779679..781090(-) | tannA_chr01 | Theileria annulata strain Ankara | 7 | OG6_100562 | 0 | 438 | 1317 | 50586 | 8.31 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=TA20965ORrhomboid family integral membrane protein, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA20965 OR rhomboid family integral membrane protein, putative AND Theileria annulata strain Ankara |
|
TA21055 | TA21055-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 1209 | TA21055 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 3863733 | Q4UGU5 | 1 | tannA_chr01:749,800..751,211(+) | tannA_chr01:749800..751211(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101895 | 0 | 402 | 1209 | 44840 | 8.07 | 1 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA21055ORproliferation-associated protein 2g4, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA21055 OR proliferation-associated protein 2g4, putative AND Theileria annulata strain Ankara |
|
TA21265 | TA21265-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1731 | TA21265 | serine protease (zymogen-like), putative | serine protease (zymogen-like), putative | 3863735 | Q4UGQ4 | 1 | tannA_chr01:673,067..675,175(-) | tannA_chr01:673067..675175(-) | tannA_chr01 | Theileria annulata strain Ankara | 10 | OG6_105727 | 0 | 576 | 1731 | 65338 | 7.06 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=TA21265ORserine protease (zymogen-like), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA21265 OR serine protease (zymogen-like), putative AND Theileria annulata strain Ankara |
|
TA21275 | TA21275-t26_1 | 16 | 16 | 1 | | | forward | protein coding | No | 2130 | TA21275 | ubiquitin carboxyl-terminal hydrolase (UBP14 homologue), putative | ubiquitin carboxyl-terminal hydrolase (UBP14 homologue), putative | 3863737 | Q4UGQ2 | 1 | tannA_chr01:668,732..671,772(+) | tannA_chr01:668732..671772(+) | tannA_chr01 | Theileria annulata strain Ankara | 10 | OG6_101380 | 0 | 709 | 2130 | 81737 | 5.11 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry);3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=TA21275ORubiquitin carboxyl-terminal hydrolase (UBP14 homologue), putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA21275 OR ubiquitin carboxyl-terminal hydrolase (UBP14 homologue), putative AND Theileria annulata strain Ankara |
|
TA21405 | TA21405-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1260 | TA21405 | 226S proteasome regulatory particle, putative | 226S proteasome regulatory particle, putative | 3863439 | Q4UGM6 | 1 | tannA_chr01:624,645..626,422(+) | tannA_chr01:624645..626422(+) | tannA_chr01 | Theileria annulata strain Ankara | 9 | OG6_101915 | 0 | 419 | 1260 | 47003 | 6.09 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=TA21405OR226S proteasome regulatory particle, putativeANDTheileria annulata strain Ankara | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=TA21405 OR 226S proteasome regulatory particle, putative AND Theileria annulata strain Ankara |